SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_075_00028.5|PACid:22039246 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_075_00028.5|PACid:22039246
Domain Number 1 Region: 307-525
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.73e-37
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0016
Further Details:      
 
Domain Number 2 Region: 5-78
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000128
Family Domains B1 and B5 of PheRS-beta, PheT 0.0052
Further Details:      
 
Domain Number 3 Region: 239-313
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000000000421
Family Domains B1 and B5 of PheRS-beta, PheT 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_075_00028.5|PACid:22039246
Sequence length 528
Sequence
MPKVSVGRDRLFEALGKEYTQEEFEDLCFEFGLELDDVATEEDEVIYKVEVAANRYDLLC
FEGLVRALRIFKELDQIPKYSVFDIPRESMLKIHVKPETALVRPYVVSAVLRDITFDQAS
YKSFIDLQDMLHQNICRGRTLVAIGTHDLDTIQGPFTYEALPPTEINFVPLKQVKSFRGD
ELMKFYESDMKLKKFLHIIEKSPVFPVIYDCNRKFEVEPVEVISSDGHSCVYPDLSAYNM
EVPLSKITGRIGVSADANQVISLLNRMQLLAEKSVLSGDLCSIIVSVPPTRSDVLEACDV
AEDFAIAYGFDNILAQVSSSTQGGGEQSLSQISNLIRLEFAMCGFTEVLTWILCSYKDIT
SMLNKKDNNSTSVKISNPRSADFEVSRTTLMPGLLKTVRENNHHPKPIKIFEVGDVVLLN
EMNDVGARNRHHLAALFCDDHSGFEVIHGLVQRIMEVMDIPCDSDSGYCIKDSDGVEEGE
FLPGSKGSIIHKGESVGSFGIVHPEVLGNFKISFPCSYMEIDLQCFFN
Download sequence
Identical sequences A0A2G5C974
Aquca_075_00028.5|PACid:22039246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]