SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_083_00029.1|PACid:22058221 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_083_00029.1|PACid:22058221
Domain Number 1 Region: 55-110
Classification Level Classification E-value
Superfamily F-box domain 8.9e-17
Family F-box domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_083_00029.1|PACid:22058221
Sequence length 197
Sequence
MKRPLEENLTVVVVDHKKKKKIKNDEEEKKKKKIKNDEEEKKKKKIKIDEEEGEFVNLDE
DLLFEVFKHVDAKSLASAACVSKQWNKTAQDERLWEMICTRHWASKTGCSTKQLRSVVLA
LGGFQCLHSHSLWPLSKPPSSSSSSAASSSAASSSSSVSSSPSMPTHWGKDEVNLSLSLL
SIRFYKNMTPMPPRRHN
Download sequence
Identical sequences A0A2G5C709
Aquca_083_00029.1|PACid:22058221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]