SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_086_00041.1|PACid:22054404 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_086_00041.1|PACid:22054404
Domain Number 1 Region: 75-171
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.06e-21
Family B3 DNA binding domain 0.012
Further Details:      
 
Weak hits

Sequence:  Aquca_086_00041.1|PACid:22054404
Domain Number - Region: 381-417
Classification Level Classification E-value
Superfamily Tropomyosin 0.0245
Family Tropomyosin 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_086_00041.1|PACid:22054404
Sequence length 429
Sequence
MPTLITSIRPDGNKFEQVVLNKPERPLRSVPSFEQVVLDKPAETPLSYEQEQAFPDHDKV
KLCAIQRAEEVRANLDPRFPSFVKSMLRSHVIKGFWMGIPGQFCKAHLPKHDVTIPLVDE
NQEEFVTNYLLHKIGLSGGWKGFAVAHKLVERDALVFQLIKATTFQVHIIRAFSLDAIDG
VIGFVTLDSDPKHSSTCKSIKTSGKRVRKRRKIVSFADVEAPTKEKFGSDSDDMGSEVLE
CIKFLETSVEFKDVKDLESFTIAVNGLVIDSELSKNERTKYYELCCSQDAFLHDNLLAGI
NMKLAAGAISETVNIANSIQSSKLGTCRDDYATWDNSLRALEQLGMNVRFLRVRILLNIA
YESEGTVDLKQYSEAIVGQARVKEEIRSMEAKLVELEKASKRMGTKIKNLEAKVRRNELK
FQTQVSSPW
Download sequence
Identical sequences A0A2G5C6M8
Aquca_086_00041.1|PACid:22054404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]