SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_091_00073.1|PACid:22057949 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_091_00073.1|PACid:22057949
Domain Number 1 Region: 152-324,389-492
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.17e-26
Family WD40-repeat 0.012
Further Details:      
 
Weak hits

Sequence:  Aquca_091_00073.1|PACid:22057949
Domain Number - Region: 484-591
Classification Level Classification E-value
Superfamily DNase I-like 0.000158
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_091_00073.1|PACid:22057949
Sequence length 599
Sequence
RASTGGHVHEYKSRFFSSSSSSSSSSLDYNYDDQEEYIPTSRKSNAHPLPEFIASGGGNG
IFQTPVRAPIPTGRPPSLELRPRPLRDTQLGSFIRIIASSDTQLWAGHESGLRFWNYSDM
YIRRMPCKNKASELRNSGDENAAPFHHSTSMSSVFCMAMDMSSRVVWSGHKDGKIRLWKM
DRSLDFDSTPFNECLAWRAHSGPVLSIAISSYGDLWSGCEGGIVKVWPWEKMEKCFSLKA
EEKHMASLLLERSYIDLRTQVTVNGACALSHADVHYMLVDNSRGKVWSAGYQSFALWDAR
TRELLKVFNIDGQISRVDMSPVRDPSVEAEMKTRFDFAPKKDKSQSSLSFLQRSRNALMG
AADAFRRAAGKGADDNNRTEALVLTGDGMIWSGCSNGLLVQWDGNGKRLRDFNHHPFAVQ
CLCTFGSRIWVGYVTGTIQVLNLDGSVLGEWIAHNSAILKMAVGAGYVFTLANHGGIRGW
DITSPDRKLRLLTCTWNVGQGKASHDSLILWLGSAASDVGIVVVGLQEVEMGAGFLAMSA
ARETVGLEGTPTGQWWLETIGKHLDEGGTFERIGSRQLAGLLIALWYDLSLSLSLIHGV
Download sequence
Identical sequences A0A2G5C5V2
Aquca_091_00073.1|PACid:22057949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]