SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_094_00009.1|PACid:22032643 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_094_00009.1|PACid:22032643
Domain Number 1 Region: 6-119
Classification Level Classification E-value
Superfamily Ribosomal proteins L15p and L18e 1.44e-27
Family Ribosomal proteins L15p and L18e 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_094_00009.1|PACid:22032643
Sequence length 123
Sequence
MTTGLKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY
FHKLRNKFYCPIVNIDKLWSLVPQEIKDKATPENAPLIDVTQLGYFKVLGKDLLIDCAVA
VEC
Download sequence
Identical sequences A0A2G5C4X3
Aquca_094_00009.1|PACid:22032643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]