SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_100_00036.1|PACid:22063730 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_100_00036.1|PACid:22063730
Domain Number 1 Region: 141-277
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.89e-40
Family B3 DNA binding domain 0.0045
Further Details:      
 
Domain Number 2 Region: 722-798
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000000000785
Family PB1 domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_100_00036.1|PACid:22063730
Sequence length 845
Sequence
MATSEISSKNGRGESCYSSGNDGGGKAMNGGFSNYKGSEEALYTELWHACAGPLVTVPRE
GERVFYFPQGHIEQVEASTNQVADKQMPVYNLRSKILCRVINVELKAEPDTDEVFAQVTL
LPEDNQDENAVEKEPSPPPPPRPHVHSFCKTLTASDTSTHGGFSVLRRHADECLPPLDMC
RQPPTQELVAKDLHGIEWKFRHIFRGQPRRHLLQSGWSVFVSSKRLVAGDAFIFLRGENG
ELRVGVRRALRQQSNVPSSVISSHSMHLGVLATAWHAVSTGTMFTVYYKPRTSPAEFIVP
YDQYMESVKNTYSIGMRFKMRFEGEEAPEQRFTGTIVGMGDADSNRWHDSKWRCLKVRWD
ETSSVPRPERVSPWKIEPAMAPALNTLPISRPKRPRAVAASPDSSVLTKEGSSKITIDSA
SVNGFSRVLQGQETSTLKNSLSENNESESVQRPVTWPPSQDDGKIDMVCGQNRYGTENWA
PMVRHEPTYTDLLSGFRSSNDSPHALATSFSERNIEDTNPLKKQWQDSEGKLVALPWSMM
PPSQSMNTLDSDMKIHSQANEISYPKAGTKYNAFSGYPVLQNIRVEQHEGNWMMPLLSSP
HSETLHHPRGIRPQPSYFQQHEVSKSKTNGNCKLFGIPLNVNPVVPEPAAPHGNVPYEPE
NHITSALPPQKALDSDHQSEQSKASKSTDTAVLGNEQEKSTPGCQQQRRDVKSKLQGGST
RSCTKVHKQGIALGRSVDLTKFSGYDELLTELDQMFDFDGELMAHSKIWQVVYTDNEGDM
MLVGDDPWQEFCSMVRKIFIYTREEVQKMTPGALNARAEDNPTNAEERTGEQETSCAAAA
SPENC
Download sequence
Identical sequences A0A2G5C474
Aquca_100_00036.1|PACid:22063730 Aquca_100_00036.2|PACid:22063731 Aquca_100_00036.3|PACid:22063732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]