SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_102_00003.3|PACid:22039010 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_102_00003.3|PACid:22039010
Domain Number 1 Region: 167-310
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.32e-41
Family Protein kinases, catalytic subunit 0.00032
Further Details:      
 
Domain Number 2 Region: 45-134
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.82e-25
Family Ankyrin repeat 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_102_00003.3|PACid:22039010
Sequence length 324
Sequence
METKIQQPRKTLVKQSSLAPEREDGTKLVKDELEVTESVEPTVRLMYLVNEGDLEGINEL
LDLGTNVNFSDIDGRTALHIAACQGRTDVVELLIRRGAQIDPKDCWGSTPLADAIYYKNH
DVIKLLEKHGAKPLMAPMHVNHRREIPEYEIDPKELDFTNTVDLTKGTFRTALWRGIKVA
VKVIGEDVISDEDKVSAFRDELELLQKIRHPNVVQFLGAVTQSSPMMIVTEYLPKGDLRA
FLKSKGALKQTTAVKFALDIARGMNYLHENKPEAIIHRDLEPSNILRDDSGHLKVADFGL
SKLLKVAKTVREDKPVMCTDISYD
Download sequence
Identical sequences A0A2G5C3T4
Aquca_102_00003.2|PACid:22039009 Aquca_102_00003.3|PACid:22039010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]