SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_108_00053.3|PACid:22046226 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_108_00053.3|PACid:22046226
Domain Number 1 Region: 300-439
Classification Level Classification E-value
Superfamily ApaG-like 3.66e-26
Family ApaG-like 0.0005
Further Details:      
 
Domain Number 2 Region: 3-65
Classification Level Classification E-value
Superfamily F-box domain 0.00000000211
Family F-box domain 0.01
Further Details:      
 
Weak hits

Sequence:  Aquca_108_00053.3|PACid:22046226
Domain Number - Region: 109-194
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000118
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_108_00053.3|PACid:22046226
Sequence length 439
Sequence
MEMEIVYLDGLGDLCLHFIALKLGPKDTAVLACVNKRLRDSAYEDSLWRTFCEKDLNITD
APHDTQGNQTQSFKVAYQLWRESFSMYPWPLVKRVHNCWATLKNWLTLHFPQASHTLQIG
ASESDIKHLEDKLSVKLPLSTKLLYRFCNGQQLPHHHHTQLGSPLGLIGGYYFYNHLVNV
YLLPLSQVIAKTKDFVRHLGFSSRSKYIVVAASSTYIEKLFFLNCITGQLYVGTNNLSTD
GEMMPCVSVPPINQRDAMLLWLEEHGRRLQTGIIHLREEAGNVPRINLFPQPPPLCSTAV
TNGVQIRASAVFVPELSNLQEESEKYWFSYSIRMSLLSEGHIASRTPLTSCQLYWRHWII
RANDVVVSDVDAEAVIGKYPLLHPDGKEFIYESCTPLPSCPGSIDGAFTFVPGRLTNPKG
GPFMVEVARFPLQLPDFIY
Download sequence
Identical sequences A0A2G5C4U9
Aquca_108_00053.1|PACid:22046224 Aquca_108_00053.2|PACid:22046225 Aquca_108_00053.3|PACid:22046226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]