SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_114_00015.1|PACid:22024757 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_114_00015.1|PACid:22024757
Domain Number 1 Region: 145-412
Classification Level Classification E-value
Superfamily Pseudouridine synthase 6.47e-66
Family Pseudouridine synthase I TruA 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_114_00015.1|PACid:22024757
Sequence length 488
Sequence
MAEGEIETSDFQYPISITKENFKSNGEGFIINLKNQLKTLENRVKELELENAKLSSQLSN
CRCRNKLVENVNYYVAHGNTLIQESKKLSVGGEKVRLFPTKGVSKDVSHEDAVGHEEKSN
VDETKEFESKERSPGCITKSIHHAPKRYVAMKIMYFGQRFYGFASQQVEPTIESEIFKAL
EKTRLLVCDKNESRYTRCGRTDKGVSSVGQVVSLLLRSKSGDTRVNGDHEKLSPEDMCGE
IDYVRVLNGVLPKDIRVISWCPVRNDFHARFSCLRRTYKYLFWRGNLNLSEMEIAGMKFV
GDHDFRNFCKMDAANVHNYRRHITSFEFSRCNSRSESDELWAMTIIGSAFLWHQIRCMVA
VLFMIGHGLELPSVIDELLDINRTPRKPQYVMAPELPLILQSCEFERLKYICSPDASQSL
REHLKNEIRHYELQAAIFQEALLSCSHAINDHSPSSHIKKKAAHIPLMSRPTEPSYEERQ
AKQKARTV
Download sequence
Identical sequences A0A2G5C2E3
Aquca_114_00015.1|PACid:22024757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]