SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_123_00011.1|PACid:22040046 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_123_00011.1|PACid:22040046
Domain Number 1 Region: 70-123
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000196
Family F-box domain 0.006
Further Details:      
 
Weak hits

Sequence:  Aquca_123_00011.1|PACid:22040046
Domain Number - Region: 191-279
Classification Level Classification E-value
Superfamily L domain-like 0.000194
Family Internalin LRR domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_123_00011.1|PACid:22040046
Sequence length 338
Sequence
MASTLDLLKSIYLPFSIEDGDGDGDGDGDGDGDGDGDGDGDSGGDFCLRENKRVKREKIE
TTPKNNELVDRLSELPDQLLHNILSLLDTKQVVQTMFLSKRWKDVWRFVSNLSFDHTPWV
YTYMQNSKWEIVTRKNGFGKFVDGVLSRLERLKVDRFSILGGGCYCDDDLVDRWISTVIR
CHVQEIYLVRILHLVSVGLQVDVSNGEMVLSLPSLETLTIWSCDHSNLRVLSICCPQLQN
LVLDNDILSGVSSCKIKICTPNFNSLKCNGCMYQDYFLENISARVTANITAYQSVYFFRL
LEVLQDLGNVETLELSLYWLTVYVMLDKFFLSKSVYAI
Download sequence
Identical sequences A0A2G5C1M0
Aquca_123_00011.1|PACid:22040046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]