SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_125_00011.1|PACid:22032703 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_125_00011.1|PACid:22032703
Domain Number 1 Region: 21-429,457-512
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.81e-133
Family Pyridoxal-dependent decarboxylase 0.00000000591
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_125_00011.1|PACid:22032703
Sequence length 518
Sequence
MGSLHVEDLDNSSKCVENPLDPEEFRRQGHMMIDFLADYYRDIEKYPVRSQVEPGYLRKE
LPDSAPYNPEPIETILEDVQKQIIPGITHWQSPNYFAYFPSSGSIAGFLGEMLSTGFNVV
GFNWMSSPAATELESIVMDWLGKMLKLPKSFLFSGNGGGVLQGTTCEAILCTLTAARDRT
LNKIGRENICKLVVYGSDQTHCALQKAAQIAGIHPKNFRAVPTTKSDGYGLSPNALRSTI
LADIEAGLVPFFLCATVGTTSSTAVDPLGPLCEVANDYRIWVHVDAAYAGSACICPEFRH
FIDGVENADSFSLNAHKWFFTTWCCCLWVKDPSALVKALSTNPEYLRNNATESKQVVDYK
DWQIALSRRFRSMKLWLVLRSYGVANLRNFLRSHVKMAKNFEGFVALDKRFEIVVPRTFA
MVCFRLLLPGSPLLMNGYQNGYQNGNGVYHKDETRANELNRRLLESINASGSAYMTHSMV
GGVYMIRFAVGASLTEERHVISAWKVVQEHADAILATF
Download sequence
Identical sequences A0A2G5C1E4
Aquca_125_00011.1|PACid:22032703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]