SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_125_00026.1|PACid:22032720 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_125_00026.1|PACid:22032720
Domain Number 1 Region: 2-236
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.4e-41
Family Voltage-gated potassium channels 0.003
Further Details:      
 
Domain Number 2 Region: 241-434
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.84e-38
Family cAMP-binding domain 0.0043
Further Details:      
 
Domain Number 3 Region: 501-578
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.87e-19
Family Ankyrin repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_125_00026.1|PACid:22032720
Sequence length 715
Sequence
MFLIFLVVYSAWISPFQFGFLTYKQDTLFVIDNIVNTLFAIDIILTFFVAYLDRGSYHLI
DDPKKIATRYISTWFIFDVCSTAPFQPLSLLFTEHSSDLGFKALSMLRLWRLRRVSSLFA
RLEKDIRFNYFWTRCTKLISVTLFAVHCAGCFNYLLADRYPDPKRTWIGAVIPNFKEESL
WNRYVTAIYWSITTLSTTGYGDLHAENPREMLFDIFYMLFNLGLTAYLIGNMTNLVVHGT
SRTRNFRDAVQAASEFTARNQLPKYIQDQMLSHICLKFRTEELKQQEMLNSLSKAIRSSI
AHYLFFPIVQKAHIFHGVSNNFLFQLVSEMEAEYFPPKEDVILQNEAPTDLFILVSGAVE
LIASTNGHVQGCVKVVVGDAFGEIGVLCHRPQPFTARTTELSQILRVNRTSLTNIIQTNI
EDGEIIMNNLLQKLKDPSSVGFKDADAYLGCMTKQWMDEGHLLGKFAHVGEQEYHPQRDP
SIHETTDTDISIHDTTEKREMDETNDLIKCGADINLTDKYGQTALHVAVHKGNLQTIKTL
LDQGANVNKADSRGWTPKNLAQLLEQKSIYDLLQTYEDRNRNLENHKIELMELGKANSFK
YDQGKDRRKGILNFVNPHSFQVATESNSGSCSCNSVSQIMNLAKRRVTIHMNFHKENVSD
IQLGKLITLPDSLEELLRIAGQKFEGHHPTKVINRENAEIDDISVIRDGDHLFLQ
Download sequence
Identical sequences A0A2G5C1E9
Aquca_125_00026.1|PACid:22032720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]