SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_142_00001.1|PACid:22063987 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_142_00001.1|PACid:22063987
Domain Number 1 Region: 69-195
Classification Level Classification E-value
Superfamily 14-3-3 protein 3.01e-21
Family 14-3-3 protein 0.00011
Further Details:      
 
Domain Number 2 Region: 263-360
Classification Level Classification E-value
Superfamily 14-3-3 protein 0.0000000000209
Family 14-3-3 protein 0.0005
Further Details:      
 
Weak hits

Sequence:  Aquca_142_00001.1|PACid:22063987
Domain Number - Region: 204-229
Classification Level Classification E-value
Superfamily 14-3-3 protein 0.068
Family 14-3-3 protein 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_142_00001.1|PACid:22063987
Sequence length 388
Sequence
MDCWATIHNVELSVDHEIIDTRPIVVCGVALALAQDKWVGFEMERKEESRLIRERKVNNS
KMMASQFLREECVYLAKLSKVLFRYGDMREFMEGVAKMGVKELTNDERYLLCFAYKKIIR
VKINTWKVICSIEQKEKNLAKVERAKIISKYKNKIGFDISMICLAILELLESENSYLIEQ
TLPKESYKFYLENLAEHIDMTMGNRIENELTKICDVILNILESHLVSHNTLLGVSAESFA
YLYTDYFILKEKIDYKIVSKLSLEDNVYLASVAEEAEQYDDVVEVMRNIVEKVGVEKLTL
EQRYILHLAYEKLLLSIGASWRLLIMFTIRGNSTVITEKYWNMIRSELDKMYDELEKLMQ
PKAPEMQQHTFEKSPCKYYFEIQSVLNT
Download sequence
Identical sequences A0A2G5C0X3
Aquca_142_00001.1|PACid:22063987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]