SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_316_00003.1|PACid:22044546 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_316_00003.1|PACid:22044546
Domain Number 1 Region: 744-1072
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.74e-68
Family Protein kinases, catalytic subunit 0.00024
Further Details:      
 
Domain Number 2 Region: 312-666
Classification Level Classification E-value
Superfamily RNI-like 2.43e-63
Family Cyclin A/CDK2-associated p19, Skp2 0.023
Further Details:      
 
Domain Number 3 Region: 89-386
Classification Level Classification E-value
Superfamily L domain-like 4.19e-59
Family Polygalacturonase inhibiting protein PGIP 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_316_00003.1|PACid:22044546
Sequence length 1087
Sequence
MDVIEVFKHYCWYMLDYKSSIVIILPVKLYIAYVKGSLSTIKSTMELPSHAICTQFSFKQ
LICLFCFICMFSLSSFKSDSAALVTASPVNESDRFALLAIKSQIPDDPLGALTLWNDSLH
HCNWQGITCSRRHRERVTVLDLQNKELGGTVSPYIGNLTFLKEITLTKNNFHGEIPKEIG
RLFRLQKLHLDNNSFEGEIPSNITYCSDLRQINLVDNKLSGSIFAGISSLSKLLILSLAK
NNFSGRIPPSLGNLTSLTDLSLAYNHLEGNIPDDLCSIRSLSFFQIGINNLTGKIPSCLF
NYSSMYRFACTGNRLEGSLPPNIGLTLPNLKNMFLGGNKFSGHIPVSLSNATRLEVFDIA
LNAFTGSVPSDLGKLQALRWLGFGVNQIGTQQGGDDLNFINSLTNCSNLEYLDFSENVLK
GPLPDSISNLSTTIRLLNMQQNSIYGSIPVGIGNLVNIEKISFYINNFSGAIPTSIGKLN
QLRELYLGKNLLSGQIPSSLGNLTQLTTLSLSENNLSGSIPPTLGNCQNLEQLDLSANNL
VGTIPKQVVSISSLSTGLFLSQNSLTGSLPLEVGNLTNIMELVISDNQLSGHIPKLLGDC
LNLNLLYMDGNFLEGEIPKSLITLKGLVSLDISRNKLSGKIPKYFEQFPNLNYLNLSFNL
LEGQVPLNGVFANASFVSVDGNPNLCGGIEGLKLSPCIQKETKKKTSLSFKVIIPIIVGS
VCLLLSLLFFLVVCRKKVLNKAQSSTTFSNIPSYMRVSYMELLRATNGFSVDYLIGVGSY
GSVFKGILQDINQTVAVKVINLQQEGASKSFITECNALRHLRHRNLLKIKTACSSVDLLG
NDFRALVFEFMPYGSLEEWLHPRVNGQQHGPRNLSFIQRLNIAIDVASALEYLHHRCQPC
VVHCDLKPSNVLLDEDMTARVADFGIAKLFSAASYDSAQSQPSSEVIRGSIGYVAPEYGM
GVKVSMQGDVFSYGILLLEMFTRKRPTDDMFLNGLSLHNYAEMALPNQVMGIVDPLVVLL
EDTNEISNIVEQNNTRARLEECLVSAITLGVTCSAEVPAERMTMSVVVSELLHIKKHYQT
IFRSISE
Download sequence
Identical sequences A0A2G5C0H8
Aquca_316_00003.1|PACid:22044546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]