SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HMPREF0010_01215T0 from Acinetobacter baumannii ATCC 19606

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMPREF0010_01215T0
Domain Number 1 Region: 14-403
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 1.02e-139
Family ArgJ-like 0.00000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HMPREF0010_01215T0
Sequence length 406
Comment | HMPREF0010_01215 | Acinetobacter baumannii ATCC 19606 ArgJ protein (407 aa)
Sequence
MAVGDVTMPQMHVVKGVKIGSTEAYVRYPNRRDLVIFEFAEGSNVAGVFTQNAFCAAPVH
VSKAHLAEGNPRYLVINTGNANAGTGPIGLKNAQDTCAKLAELAGVNSFEVLPFSTGVIG
EQLPMERLLAGLQPALNSVQDAAWSDAASGIMTTDTVPKGASEQFELDGMTYTMTGISKG
AGMIRPNMATMLSFVATDAPIRRDLVQKLLKTTVEHSFNRITIDGDTSTNDSCIFVATGQ
AGGAEITSESDVRYAKVLEVLARVMNRLAQLIVRDGEGATKFITVAVEGGANTQECCDIA
YSIAHSPLVKTALFASDPNWGRILAAIGYAGVKDLDVSKIQVWLDDVQICKDGGAAEDYT
EEAGARVMAQTEITIRVDLGRGQAKDTVYTCDLSYDYVKINADYRS
Download sequence
Identical sequences A0A1C9CQY6 D0C9A2 L9P5T9
WP_000268123.1.12358 WP_000268123.1.13124 WP_000268123.1.13788 WP_000268123.1.27656 WP_000268123.1.30173 WP_000268123.1.35479 WP_000268123.1.36381 WP_000268123.1.37180 WP_000268123.1.42011 WP_000268123.1.43672 WP_000268123.1.57250 WP_000268123.1.59417 WP_000268123.1.61681 WP_000268123.1.62032 WP_000268123.1.64658 WP_000268123.1.67141 WP_000268123.1.73636 WP_000268123.1.77164 WP_000268123.1.80712 WP_000268123.1.88851 WP_000268123.1.96530 WP_000268123.1.97404 HMPREF0010_01215T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]