SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HMPREF0012_00043T0 from Acinetobacter calcoaceticus ruh2202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMPREF0012_00043T0
Domain Number 1 Region: 41-282
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.59e-64
Family Phosphate binding protein-like 0.00000885
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HMPREF0012_00043T0
Sequence length 292
Comment | HMPREF0012_00043 | Acinetobacter calcoaceticus RUH2202 conserved hypothetical protein (293 aa)
Sequence
MKKLFSVLFSASVLTLTACNKQPAQTENTAPAKDKTESVRTIKLVSTGSDTDVWKYVATL
PETKEAGIKLEVTNLTDYVVLNTSVASGEQDVNAFQSFNYLAAYNASNTAKVAAVATTYL
EPMGLYANKVKTVDEFPQGATIAIPNDTANEARALTLLQSAKLIKLKPDFDPVKGTTNDI
AENPKGLKLKPIQMTTAVRVKDDVDAIVLGNTLALEGGLNVLKDSIFREPIDQSTKLYVN
LLGVAEANKNDPIYTKLGELYHLPKVQKFVSEKFAGTKVEVNKPVSEFTDIK
Download sequence
Identical sequences D0S128
HMPREF0012_00043T0 WP_003650130.1.32237 WP_003650130.1.78621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]