SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HMPREF0012_00587T0 from Acinetobacter calcoaceticus ruh2202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMPREF0012_00587T0
Domain Number 1 Region: 40-254
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.96e-33
Family Phosphate binding protein-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HMPREF0012_00587T0
Sequence length 340
Comment | HMPREF0012_00587 | Acinetobacter calcoaceticus RUH2202 ABC-type nitrate/sulfonate/bicarbonate transport system (341 aa)
Sequence
MIKKAFLSVSILSAVVLGGCDNTAKVPEAKQDAQAATNIKPITIGYSDWPGWVAWQVAIE
KGWFKEAGLNVEFKWFDYSASLSAFSANQLDAVLVTNGDNLVTASGGTQGMMIMATDYSA
GNDVIIAKEGINTIQDLKGKSIGVEKGLVDHLLLATALTDHNIKASEVKLVNSATNQLPQ
VFNSPDISAIAVWQPVAGQALKAVAGSKIIYTSKDKPGLIYDTLTVNMSHLTAHQEEWKK
IIQVWDKTVKYINDPATHADAVKIMANRSGVDPKQYESMVSGTHLLDINANKKVFAKSQG
FDSIYGSSYHVNKFNVENGIYKTEQNVDGLIYPTLVEQLK
Download sequence
Identical sequences D0S2Q1
HMPREF0012_00587T0 WP_003651032.1.78621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]