SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HMPREF0012_00695T0 from Acinetobacter calcoaceticus ruh2202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMPREF0012_00695T0
Domain Number 1 Region: 10-265
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.32e-60
Family Phosphate binding protein-like 0.000000718
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HMPREF0012_00695T0
Sequence length 286
Comment | HMPREF0012_00695 | Acinetobacter calcoaceticus RUH2202 ArtI protein (287 aa)
Sequence
MFKRNSIKILSSIAVAGVLLTACSKTPSTEQASNTQEDQSLEQVKKNGVLRVAVFADDPP
FGYVDSAGNNQGFDVALAKRVTKDLLGDEKKVEFIVTEASNRVEFLKSNRADVVFATFTV
TPERKEVVDFAEPYLKGAFGIVSPKAKPITDIAQLEGKTLIVNKGTSSDTYFTKHYPKVN
LLKFERNSDAFKALTDGRGDAISQDSTYALAWAAKNPSYVAGIQSIGDQEFIAPAVKKGN
TQLLNWLNTEIKQLRTSGEIKKIYDETLKPIYGESVNPNVFLDVGQ
Download sequence
Identical sequences A0A0A8XMD1 A0A0Q5G370 D0S309
HMPREF0012_00695T0 WP_003651209.1.35409 WP_003651209.1.35949 WP_003651209.1.78621 WP_003651209.1.94978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]