SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HMPREF0012_00696T0 from Acinetobacter calcoaceticus ruh2202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMPREF0012_00696T0
Domain Number 1 Region: 11-270
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.3e-58
Family Phosphate binding protein-like 0.00000011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HMPREF0012_00696T0
Sequence length 288
Comment | HMPREF0012_00696 | Acinetobacter calcoaceticus RUH2202 amino acid ABC transporter periplasmic protein (289 aa)
Sequence
MTTLTLQNIKHVLAASLLSLGLVACDKGTQSNEKTADSTQTVSSIEQIKKNGVVRIGVFS
DKPPFGYLDAQGKNQGFDVEIAKHVAKDLLGDENKVEFVLTEAANRVEYLKANKVDIIFA
NFTVTPERKEVVDFAKPYLKVALGVVSPKSHPITDIAQLKDKTLLVNKGTTADSFFTKTH
PEIKLQKYEQNTETFDALKDGRGAALAHDNLLVLAWAKENPNYTVGITNLGEQDLIAPAV
KKGDKELLDWLNQDLEKLAKEGVIHQAYKKTLKPVYGDTINPKDLLVE
Download sequence
Identical sequences D0S310
HMPREF0012_00696T0 WP_003651210.1.78621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]