SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HMPREF0012_00700T0 from Acinetobacter calcoaceticus ruh2202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMPREF0012_00700T0
Domain Number 1 Region: 249-648
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.34e-123
Family Cystathionine synthase-like 0.0000000071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HMPREF0012_00700T0
Sequence length 653
Comment | HMPREF0012_00700 | Acinetobacter calcoaceticus RUH2202 selenocysteine lyase (654 aa)
Sequence
MTTQLTTSNLQGSPTGPEVTGVNPPANFPDESTIARLANEFFSALPSSGNSASPSGLNLD
LPVGTPPHPPQPGEPFSALSGRAPNIAFQKSLNPEYPEHIPNLPDYPERRIVASAPVVGG
ANLPRPPFEPHLPQAVHSEPNVPRIEPNLPTDAGESPYYFLNDFSAPNTEEPSVKGVEDN
YSIAQSFQLPHGDQLKSLLIEDRFAADTPAKTSPSSGFYFLDLPQSGQSYSHYQPSQPTF
VASSAQPLDVHAIRRDFPILQERVNGRPLVWFDNAATTQKPQRVIDRIAYFYQHENSNIH
RAAHELAARATDAYEHARNVVARFIGAPSSKEIIFVRGTTEGINLIAKTWGEQNIGEGDE
IIVSHLEHHANIVPWYQLTKKTGAKLRVIPVDDTGQIILEELPKLINERTKLLSITQVSN
ALGTVTPVAEVIKIAHAKGVRVLVDGAQSVSHIPTDVQALDADFFVFSGHKVFGPTGIGA
VYAKPELLDTMPVWEGGGNMIQDVTFEQVVYQPAPNKFEAGTGNIADAVGLGAALEYVES
LGIHNIARYEHDLLEYGQNALSSVSGLRLIGTAHHKASVMSFTLQGYSTEQVGKALNQHG
IAVRSGHHCAQPILRRFGVEQTVRPSLAFYNTTEEIDLLVSVLHQLTRNKRTV
Download sequence
Identical sequences D0S314
WP_003651214.1.78621 HMPREF0012_00700T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]