SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HMPREF0012_00782T0 from Acinetobacter calcoaceticus ruh2202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMPREF0012_00782T0
Domain Number 1 Region: 39-272
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.24e-64
Family Phosphate binding protein-like 0.0000755
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HMPREF0012_00782T0
Sequence length 277
Comment | HMPREF0012_00782 | Acinetobacter calcoaceticus RUH2202 D-methionine transporter (278 aa)
Sequence
MAIQFKQYKPWLLGITILIVILGLVGYRYIKNKQTDDVLTIGISPPYAELLQSVANEVEK
QGVHVKLVEFSDWRAPNVAVQNGDIDANFFQQSVFLRNAVKETGYDLHAFAVGSGSHVGL
YSKKYKTLDDLPSQARVAIPNDPVNLARALILLHRAGLIQLKDSNNELSTTQDIIANPKQ
LSFVEVEGPQTAHAYNDVDLIFGFPHYLKMAKVTDPHSALFLDPIDKKYAILFVTRRDYQ
DKNQKLATFVKAFQNSKQAQDILDKDFGQGMWFQGWK
Download sequence
Identical sequences D0S396
HMPREF0012_00782T0 WP_003651333.1.78621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]