SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HMPREF0012_02305T0 from Acinetobacter calcoaceticus ruh2202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMPREF0012_02305T0
Domain Number 1 Region: 22-328
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 7.86e-87
Family Phosphate binding protein-like 0.00000000277
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HMPREF0012_02305T0
Sequence length 332
Comment | HMPREF0012_02305 | Acinetobacter calcoaceticus RUH2202 sulfate transporter (333 aa)
Sequence
MKKISIMAVAVYLGMATATQAATSFLNVSYDPTREFYQEYNQAFGKFWKQRTGQDVEFKQ
SHGGSGKQARAVATGLEADVVTLALANDIDEIVKAGFIQPNWQKEFPNNSAPYTSTVVFL
VRKGNPKNIRDWSDLTKPGVEIITPNPKTGGAPRWIYLSAWGYALKQPGGNDAKARELVK
KLYHNVKVLDSGARGSLTTFAERGIGDVLLSWENEALLATKGLDKDKYEIVYPSISILAE
PSVAIVDKTVDKDGNRTLAKGYLNFLYSPLGQDLAAKHYFRPRNAQVAAKYAAQFPKIKL
FTINDVFGGWAKAQKTHFANGAVFDQIYDGKQ
Download sequence
Identical sequences D0S4G6
WP_003653836.1.78621 HMPREF0012_02305T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]