SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HMPREF0012_03517T0 from Acinetobacter calcoaceticus ruh2202

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMPREF0012_03517T0
Domain Number 1 Region: 126-220
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.0000448
Family Phosphate binding protein-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HMPREF0012_03517T0
Sequence length 335
Comment | HMPREF0012_03517 | Acinetobacter calcoaceticus RUH2202 RND type efflux pump (336 aa)
Sequence
MKKIVLAMAAASVVGFSASAQAASTVCVFDLLGKAGDSYKMMEEWALAAKGWGTEINLVP
RQDEAVADNDFKAGKCDAVAMTAMRARQYNKFAGSIDSLGGVPNNQIAQRAITYVLDARN
AAKMTTNMGGKKYEVAGISPLGSAFIFVRDKNINSVEKAAGKKFAVLGYDDAQKIMVQRV
GAQAVLSDISNFAAKFNNGQVDMVGAPAYAYKPLELNKGLGANGVMWNFPVLHVTADLVL
RSDKFPAGFGQKSRDWFVKQLPKNFAMINRLEAQIPGKYKMNLSAEDKLKYQKMLRDGRM
DLTKRGVYDAGMMSVLKKARCSVDKANFECSMPGE
Download sequence
Identical sequences A0A0Q1QMT0 A0A0Q5F7N0 A0A151YQG4 A0A1H8TH43 D0S7V6 D8JKM2 N8WWC7 N9EU13 N9QC65 R8Y1Q1
HMPREF0012_03517T0 gi|299768259|ref|YP_003730285.1| WP_003656045.1.4475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]