SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ACTODO_00078 from Actinomyces odontolyticus ATCC 17982

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ACTODO_00078
Domain Number 1 Region: 7-215
Classification Level Classification E-value
Superfamily CutC-like 1.29e-44
Family CutC-like 0.0000826
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ACTODO_00078
Sequence length 229
Comment | Actinomyces odontolyticus ATCC 17982 hypothetical protein (230 aa)
Sequence
MAAVTTVEICVEDAVGVRRARDGGADRIEICTDLSCGGLTPAFDEVAAALEVAPAGGVQV
LVRPRPGDFVHTREEVDRIASDIMTLSSIGRGSDVRLGFVVGVITRDGQIDVNAAARLRD
TAEDAPLTFHRGFDQVADQDRGLDVLMELGYDRVLTTGGDPAVAQPDALARLVERGGDDI
IILVSGGLRAHNVAEVVAASGAREVHMRAPGTSGTDQAEVERIVAALHG
Download sequence
Identical sequences A7B8X8
ACTODO_00078 WP_003790036.1.82230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]