SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HMPREF0975_00334T0 from Actinomyces sp. F0330

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMPREF0975_00334T0
Domain Number 1 Region: 6-246
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 3.93e-80
Family Sir2 family of transcriptional regulators 0.00000356
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HMPREF0975_00334T0
Sequence length 251
Comment | HMPREF0975_00334 | Actinomyces sp. F0330 hypothetical protein (252 aa)
Sequence
MDQQDSRWGLLAQWIAESKRVVFFGGAGVSTESGIPDFRGAKGFYHQDREIPLEQVLSID
FFTVNPRAYWEWFAQENAREGVAPNAAHRFVADLERAGRLSAVVTQNIDGLHQRAGSERV
LELHGNWSRLICTGCGERFSLSDVDDARSGAVPRCRECDSVLRPDIVFYGEMLDSDVLEG
AVRAISEADLLIVAGTSLVVYPAAGLIDYYAGKRLVLMNATPTPYDSRADLIVREPVGQV
FQELERLGRLP
Download sequence
Identical sequences G9PIW3
WP_009232352.1.253 HMPREF0975_00334T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]