SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Astpho1|32752|e_gw1.00134.7.1 from Asterochloris sp. Cgr/DA1pho v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Astpho1|32752|e_gw1.00134.7.1
Domain Number 1 Region: 44-264
Classification Level Classification E-value
Superfamily Hsp33 domain 7.46e-52
Family Hsp33 domain 0.00000935
Further Details:      
 
Domain Number 2 Region: 285-330
Classification Level Classification E-value
Superfamily HSP33 redox switch-like 0.0000000000196
Family HSP33 redox switch-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Astpho1|32752|e_gw1.00134.7.1
Sequence length 334
Sequence
MLRVTTQLRHTVFSWQSCRHSPPSQWRSRHESAVLCQAAVQDEVHRCMSANNEVSLLTVS
ATRLVQEACTRHGTAPTASAALGRALLGSLLMGCFREETEKTQVTFNGNGILAGIQVISD
AHGNAKGKVGNPLADPPLRPDGKLNVGGAVGKGVLAVVRSNAQAERPFTGMVPIVSGEIG
EDLASYMVESEQTNSALGVGVSINRDASIRAAGGFLIQILPFASEETVRQLEANVQGVTS
VTELLHHGKGPRDLAEQLLHGLGLADGGFSLQPRYGPCEAADLQHRMKRAVALLGPQEVK
TILETEGKIEVTCEFCKETYQFSEEDVMKVNTQL
Download sequence
Identical sequences jgi|Astpho1|32752|e_gw1.00134.7.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]