SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Astpho1|39940|fgenesh1_pg.00101_#_27 from Asterochloris sp. Cgr/DA1pho v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Astpho1|39940|fgenesh1_pg.00101_#_27
Domain Number 1 Region: 55-140
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0000772
Family Apolipoprotein 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Astpho1|39940|fgenesh1_pg.00101_#_27
Sequence length 252
Sequence
MATKTAPQSNDLKFLGPMVDLTADVSNKGYDVASAILQKMPQPVQQVSNSASEKLTPVSQ
QVTGMLGNCVKTVDSSLDSMYSKNGKYREQLDPYVHRFVEARDVYIKKAESSLDYIREKV
PAAGQALQEQMHKGITELKRLASEPLGPEVTKKTEAAISYVDNTYQKLISTPTVKSVLDR
TKPASDNLWAKYNAMLHDPVVSMPLYHWAYNTSYSTLNWFQQTPMYSLPKAYAYPYVAPV
ADPVLKKGLGQA
Download sequence
Identical sequences jgi|Astpho1|39940|fgenesh1_pg.00101_#_27

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]