SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HMPREF0026_01785T0 from Acinetobacter junii SH205

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMPREF0026_01785T0
Domain Number 1 Region: 14-403
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 2.35e-137
Family ArgJ-like 0.00000108
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HMPREF0026_01785T0
Sequence length 406
Comment | HMPREF0026_01785 | Acinetobacter junii SH205 bifunctional glutamate N-acetyltransferase/amino-acid acetyltransferase (407 aa)
Sequence
MAVGDVTMPLMHVVQGVKIGSTEAYVRYPNRRDLVIFEFAEGSNVAGVFTQSAFAAAPVL
LSKKHLAENTTRYLIINTGNANAATGTVGYKNAETTCAKLAQLAGVQANQILPFSTGVIG
EQLPIERLVQGIQPALNDLNADRWAEAASGIMTTDTTPKGASEQFELDGVTYTMTGISKG
AGMIRPNMATMLSFVATDAPISKVLVQQLLLTTVEHSFNRITIDGDTSTNDSCIFVATGL
AGGAEIESQDDPRYQQVLEVLARIMNRLAQLIVRDGEGATKFITVQVEGGANTQECCDVA
YSVAESPLIKTALFASDPNWGRIVMAIGKAGVPNLDSSKVQVWLGDVQICLDGGANPDYT
EEAGAAVMAEKEITIRIDLGRGEAKDTVYTCDFSYDYVKINADYRS
Download sequence
Identical sequences D0SKY7
HMPREF0026_01785T0 WP_005403181.1.93638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]