SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HMPREF0026_02708T0 from Acinetobacter junii SH205

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMPREF0026_02708T0
Domain Number 1 Region: 19-237
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 4.19e-52
Family PP-loop ATPase 0.0000695
Further Details:      
 
Domain Number 2 Region: 240-322
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 8.24e-19
Family MesJ substrate recognition domain-like 0.0013
Further Details:      
 
Domain Number 3 Region: 352-442
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.000000000000191
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HMPREF0026_02708T0
Sequence length 463
Comment | HMPREF0026_02708 | Acinetobacter junii SH205 tRNA(Ile)-lysidine synthetase (464 aa)
Sequence
MRSTLSTFNEVWQQQFRHRVLAQTQHFSKDTQFLIGCSGGMDSMLLLYLMSEIFPSQTRS
IYIDHQLQSSSTEWGCLVQKQSEQLNIPCVIQKVHVDAGNLEQQARHARYQAYIKHLKSH
EILVLAHHQQDQAETLLLRLFSGAGVNGLSAMQAYDVRKDLTIWRPFLELSRQQIEEWAK
QIGFDYVVDPTNHDTHYDRAWCREELWPVLEKRFPKMQSAVSRTSYLMQDATEILDDVLQ
SDWKLCATENELDLTRLLELSDARKRQLLSAWIKGKDQYRPSYDMVKRLQDEVIFAKPDA
QATLHINSYYYVRYQKKLYRLTHAELYAEKLFPIQPIMNQSYNLEEMIQTASGKFKILTQ
DIGLSKQLLNKDLKLIKRQGGEKIHLYGRIGHWPLKKAIQEAQILPWFRHTIQILVVENV
MLGVFSPKGFWLAQSDYIEQGGWQPSLVSDCRENSPQSFSNDE
Download sequence
Identical sequences D0SQE8
WP_005403743.1.93638 HMPREF0026_02708T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]