SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HMPREF0016_03239T0 from Acinetobacter johnsonii SH046

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMPREF0016_03239T0
Domain Number 1 Region: 14-403
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 8.37e-137
Family ArgJ-like 0.00000247
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HMPREF0016_03239T0
Sequence length 406
Comment | HMPREF0016_03239 | Acinetobacter johnsonii SH046 glutamate N-acetyltransferase (407 aa)
Sequence
MPVGDVSMPQMHVVKGVRIGTAEAYVRYQNRRDLVIFEFAEGTNVAGVFTQNAFCAAPVH
VSKAHLHVANPRYLIINTGNANAGTGKTGMLNAERTCAKLAELARVQATEVLPFSTGVIG
EQLPLERLLNGLQPALNSLSADAWDAAATGIMTTDTTPKGASEQFELDGITYTMTGISKG
AGMIRPNMATMLGYVATDAPISRELVQQLLSETVNVSFNRITIDGDTSTNDSCIFAATGQ
AGGVEICSTQDARYTVVLDVLTRMMKRLAQLIVRDGEGATKFITVAVEGGHDTQECCDIA
YSIAHSPLVKTAIFASDPNWGRILAAIGYAGVKNLDVEKIQVWLDDVQICKDGGAAADYT
EAEGARVMSQAEMTIRVDLGRGAAKDTVYTCDLSYDYVKINADYRS
Download sequence
Identical sequences D0SHB6
WP_005401949.1.2557 HMPREF0016_03239T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]