SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HMPREF0016_01480T0 from Acinetobacter johnsonii SH046

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMPREF0016_01480T0
Domain Number 1 Region: 298-457
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000692
Family Tetratricopeptide repeat (TPR) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HMPREF0016_01480T0
Sequence length 479
Comment | HMPREF0016_01480 | Acinetobacter johnsonii SH046 peptidase family M48 family protein (480 aa)
Sequence
MKRFLCACSLSLISTVGFAEGQFLTNAPQFNVPEIGSGIGFIDQYNERYIGEKVYREVQR
QLPVTQNPWLEDQLMNAFSSILSQTQLGQPIGLVVINDPQINAFAVPGGLFALNAGLITN
ASNMDEVAGVMAHEIAHVTQRHYSRSQEAFKGQGLLALAGILFGALVASQADGDVGSAVM
VGTQAALMDKQLSYSRNQEREADRIGMHYMYSAGYNPQSMADFFEVMHRATSRVSFLPDF
WFTHPLTTERMSEARLRANQLPKVKSTWRDEDFEILKLYTMVISNQATEQQLQMLVSRNS
YAAQLALASFYLKQGDYKLAQQVLDQAKSHQKLHNLQTLIQTDILLGQNRVNEALAVIQS
PASIMPENRALNYKLAEVYIRQNRPELAQPVLNRFLKNNPRDMNAWRLMQQAASLDKKSS
MHTINVLRYRAEVQFWSGFEEEAIKSLLHAQRLAKDNESMSATIKTRLTQMQKDRQFRA
Download sequence
Identical sequences D0SCA7
HMPREF0016_01480T0 WP_005400623.1.2557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]