SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HMPREF0016_01524T0 from Acinetobacter johnsonii SH046

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMPREF0016_01524T0
Domain Number 1 Region: 195-293
Classification Level Classification E-value
Superfamily TPR-like 0.000000976
Family Tetratricopeptide repeat (TPR) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HMPREF0016_01524T0
Sequence length 303
Comment | HMPREF0016_01524 | Acinetobacter johnsonii SH046 conserved hypothetical protein (304 aa)
Sequence
MNLMMLKPLAVAVLAVSFLTACSSNPTKNNSDTIVFTEPELTAPFYALNPFNYDAPPPFE
INLKKAAAQPVTKMEVIRSDDPSKKLVLDTNKLIIPTVNSKDRQLKFAVLAGDNEVDITE
IDDFLQLVEGKARHYPPRFTERQERKGFELKLKEVTQQLDTLASKDNASFDVLVRAFKAS
VMARNLDLGSVYTTKSLAYAQRILKINQEDPEANFWFGFALSEGGGQREAMPYLDKAMKA
GVQEAYLATANNYIAMEQKKNAVQTLKNYKLKYPQEAEVADRLISEIEKQGRWNVWQVLN
TAK
Download sequence
Identical sequences D0SCF1
HMPREF0016_01524T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]