SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HMPREF0017_02605T0 from Acinetobacter lwoffii SH145

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMPREF0017_02605T0
Domain Number 1 Region: 14-403
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 9.02e-138
Family ArgJ-like 0.00000206
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HMPREF0017_02605T0
Sequence length 406
Comment | HMPREF0017_02605 | Acinetobacter lwoffii SH145 N-acetylglutamate synthase (N-acetylornithine aminotransferase) (407 aa)
Sequence
MAVGDVSMPQMHVVKGVKIGSAEAYVRYQNRRDLVIFELAAGSNVAGVFTQNAFCAAPVH
VSKAHLQAGNPRYLVINTGNANAGTGPTGMANAEATCAKLAELAGVQAAEVLPFSTGVIG
EQLPMERLLTGLQPALDSLRDDAWGDAATGIMTTDTTPKGASEQFELDGVTYTMTGISKG
AGMIRPNMATMLGYVATDAPISRELVQQLLTETVNVSFNRITIDGDTSTNDSCIFIATGQ
AGGAEITSTEDPRYAVVLDVLTRTMKRLAQLIVRDGEGATKFITVTVEGGGNTQECCDIA
YSIAHSPLVKTAIFASDPNWGRILAAIGYAGVPNLDVAKIQVWLDDVQICKDGGAAADYT
EAAGARVMAQAEMTIRVDLGRGQAKDTVYTCDLSYDYVKINADYRS
Download sequence
Identical sequences A0A098YLD5 D0SZ81 K2FPE7 N9GB92 N9HSU0 N9QH19
HMPREF0017_02605T0 WP_004281676.1.15330 WP_004281676.1.1813 WP_004281676.1.51348 WP_004281676.1.54966 WP_004281676.1.69893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]