SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|339634356|ref|YP_004725997.1| from Weissella koreensis KACC 15510

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339634356|ref|YP_004725997.1|
Domain Number 1 Region: 63-313
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 5.98e-47
Family L-arabinose binding protein-like 0.00029
Further Details:      
 
Domain Number 2 Region: 3-63
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000000000000225
Family GalR/LacI-like bacterial regulator 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|339634356|ref|YP_004725997.1|
Sequence length 330
Comment LacI family transcription regulator [Weissella koreensis KACC 15510]
Sequence
MNKKITINEIAKSANVSKTTVSRFLNKKYENMSEATKTKIEETIKSYGYQPNRQAQTLKT
NSSLTIGISVADLSNLYTSRLLKGISQAVLDTNYQLLIMDADNHIERELSNLQMLLNENV
DGIILQPLSHLPAQYQLLTERNLPVIQVDRYVEPFTFPAVVSDNFQKSLEIADLIQAKSY
EQVIVIANKISGISSRMNRFDGLSNALFDTSIAVTLIEIDLDDAWQTHLTSLIQKNIRSA
IFALNGQVLWEVVRYLQTKHIQYPDDVGLIGYDDDNFADLIQPGISVIKQEPLQIGQSAA
DQLLSNLQNNAPLSIENMRIPATIELRESI
Download sequence
Identical sequences F8HY32
WP_013989316.1.42504 gi|339634356|ref|YP_004725997.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]