SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HMPREF0014_01668T0 from Acinetobacter genomosp. 13TU RUH2624

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMPREF0014_01668T0
Domain Number 1 Region: 7-104
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.54e-27
Family N-terminal domain of molybdate-dependent transcriptional regulator ModE 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HMPREF0014_01668T0
Sequence length 116
Comment | HMPREF0014_01668 | Acinetobacter sp. 13TU RUH2624 transcriptional regulator modE (117 aa)
Sequence
MKEKYLKLQIRILLEQNIAFGPGKADLLEAIEKTGSISQAAKSMNMSYRRAWQLVDTMNQ
CFETALVETQTGGTHGGGAAVTALGHKVLEHYRQMEINARQALEYDYQIMSSYLKK
Download sequence
Identical sequences WP_006580919.1.56063 HMPREF0014_01668T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]