SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HMPREF0013_00616T0 from Acinetobacter sp. SH024

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMPREF0013_00616T0
Domain Number 1 Region: 51-282
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.44e-43
Family Alanine racemase-like, N-terminal domain 0.00042
Further Details:      
 
Domain Number 2 Region: 275-409
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 2.02e-40
Family Alanine racemase 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HMPREF0013_00616T0
Sequence length 430
Comment | HMPREF0013_00616 | Acinetobacter sp. SH024 conserved hypothetical protein (431 aa)
Sequence
MKLKTKFSHLAYSCALILFGSVQFAHAAPLLTPHVTNEVSPAPTANAWIEIDTQAFEDNI
KRTNQLLNGKTQLCIVMKANAYGHSIDLLMPSVMKLNVSCIGITSNAEAAMVRKHGYKGK
ITRLRTATDSEIINAQALNIEELLGNYDQAARMSKWAEANNTTVHYSLALNSGGMDRNGL
EMATALGKEQAVAITKLPHLKIDGIMTHYAVEDEKFVRERLAQFNEQTAWLIKKAKLNRK
ELTLHTANSFATVNVPESHLDMVRAGAIIYGDFPNHPEFKGMMAFKTQIAAVNNYLKDST
VGYDQTYTLKRDSRLANLPVGYSDGYRRSFSNKAFVLINGQKAPVVGRVSMNTVMVDVTD
IPEAKAGDEVVLFGHQGNAEVKTSDLTSLTGHILTEAYIPWSNSNPQVVKPLQSQQQVIL
TNNKVAAKAN
Download sequence
Identical sequences A0A009H6Y8 A0A009M975 A0A010WJL9 A0A011JK52 A0A062DT21 A0A062GXC4 A0A1C2RUB1 A0A1S2FDF6 K9CDB0
HMPREF0013_00616T0 WP_002114277.1.10172 WP_002114277.1.10577 WP_002114277.1.15324 WP_002114277.1.16785 WP_002114277.1.17255 WP_002114277.1.19026 WP_002114277.1.21157 WP_002114277.1.22540 WP_002114277.1.24130 WP_002114277.1.24272 WP_002114277.1.27093 WP_002114277.1.28356 WP_002114277.1.28666 WP_002114277.1.32082 WP_002114277.1.32712 WP_002114277.1.33112 WP_002114277.1.33990 WP_002114277.1.34068 WP_002114277.1.3591 WP_002114277.1.38165 WP_002114277.1.38536 WP_002114277.1.3878 WP_002114277.1.41946 WP_002114277.1.44199 WP_002114277.1.44502 WP_002114277.1.44518 WP_002114277.1.45892 WP_002114277.1.46031 WP_002114277.1.47248 WP_002114277.1.47968 WP_002114277.1.53806 WP_002114277.1.54053 WP_002114277.1.5629 WP_002114277.1.57061 WP_002114277.1.59296 WP_002114277.1.61872 WP_002114277.1.62133 WP_002114277.1.65610 WP_002114277.1.66414 WP_002114277.1.68333 WP_002114277.1.71795 WP_002114277.1.72314 WP_002114277.1.74047 WP_002114277.1.74342 WP_002114277.1.75893 WP_002114277.1.77264 WP_002114277.1.77640 WP_002114277.1.8016 WP_002114277.1.83027 WP_002114277.1.83233 WP_002114277.1.8589 WP_002114277.1.86200 WP_002114277.1.93042 WP_002114277.1.9318 WP_002114277.1.93557 WP_002114277.1.9494 WP_002114277.1.96439 WP_002114277.1.97698 WP_002114277.1.98297 WP_002114277.1.98696 WP_002114277.1.98783 WP_002114277.1.99031 WP_002114277.1.99121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]