SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HMPREF0013_02047T0 from Acinetobacter sp. SH024

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMPREF0013_02047T0
Domain Number 1 Region: 25-281
Classification Level Classification E-value
Superfamily PLP-binding barrel 7.72e-80
Family Alanine racemase-like, N-terminal domain 0.00000457
Further Details:      
 
Domain Number 2 Region: 255-412
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 1.55e-50
Family Eukaryotic ODC-like 0.0000894
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HMPREF0013_02047T0
Sequence length 416
Comment | HMPREF0013_02047 | Acinetobacter sp. SH024 conserved hypothetical protein (417 aa)
Sequence
MSFTRINGVLHAEQCSMEQLAQQFGTPLYVYSKAAFEKHYLDMDRAFDFIDHQICFAVKS
NSNIAVLNVLAKLGAGFDIVSGGELARVLKAGGDASKVVFSGLGKTEADIETSLNVGIAC
FNVESYAELDRLQKVAARIGKKAPISLRVNPDVDAKTHPYISTGLKENKFGIPSDTVYET
YQYAASLPNLEIIGIDCHIGSQLTETKPFVDALDRVMLMIEELKKLGITLKHIDIGGGLG
VCYKDETPPSVEEYANSMKPALEKLGLKVYMEPGRSISANAGVLLTKVDLLKPTSHRNFA
IIDAAMNDLIRPALYEAWMDIQPVVPSSDTEEKTWDLVGAICETGDFIGKDRSLALKEND
LLAVLGAGAYGFVMSSNYNTRGRAAEVMVSGDKAHLIRERETVESLWENERLLPEE
Download sequence
Identical sequences A0A009H573 A0A009MKL3 A0A010VQH6 A0A011J0N4 A0A022KP08 A0A062DZS1 A0A062GK99 A0A062MNQ2 A0A1C2UWJ7 K9CB29
HMPREF0013_02047T0 WP_002118492.1.10172 WP_002118492.1.10577 WP_002118492.1.15127 WP_002118492.1.15324 WP_002118492.1.16785 WP_002118492.1.17255 WP_002118492.1.19026 WP_002118492.1.19659 WP_002118492.1.21157 WP_002118492.1.22540 WP_002118492.1.24130 WP_002118492.1.24272 WP_002118492.1.27093 WP_002118492.1.28666 WP_002118492.1.32082 WP_002118492.1.32712 WP_002118492.1.33112 WP_002118492.1.33990 WP_002118492.1.34068 WP_002118492.1.34672 WP_002118492.1.3591 WP_002118492.1.38165 WP_002118492.1.38536 WP_002118492.1.3878 WP_002118492.1.40405 WP_002118492.1.41946 WP_002118492.1.44199 WP_002118492.1.44502 WP_002118492.1.44518 WP_002118492.1.44895 WP_002118492.1.45892 WP_002118492.1.46031 WP_002118492.1.47248 WP_002118492.1.47968 WP_002118492.1.54053 WP_002118492.1.5629 WP_002118492.1.57061 WP_002118492.1.59296 WP_002118492.1.60333 WP_002118492.1.61872 WP_002118492.1.62133 WP_002118492.1.65610 WP_002118492.1.66414 WP_002118492.1.68333 WP_002118492.1.68495 WP_002118492.1.69405 WP_002118492.1.70636 WP_002118492.1.71795 WP_002118492.1.72314 WP_002118492.1.74047 WP_002118492.1.74342 WP_002118492.1.75893 WP_002118492.1.77264 WP_002118492.1.77640 WP_002118492.1.8016 WP_002118492.1.83027 WP_002118492.1.83233 WP_002118492.1.8589 WP_002118492.1.86200 WP_002118492.1.89761 WP_002118492.1.93042 WP_002118492.1.9318 WP_002118492.1.93557 WP_002118492.1.9494 WP_002118492.1.96439 WP_002118492.1.97698 WP_002118492.1.98297 WP_002118492.1.98696 WP_002118492.1.98783 WP_002118492.1.99031 WP_002118492.1.99121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]