SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aech_01009 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_01009
Domain Number 1 Region: 329-456
Classification Level Classification E-value
Superfamily Plus3-like 7.59e-45
Family Plus3 0.00000222
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_01009
Sequence length 678
Comment [mRNA] locus=scaffold99:1964122:1966833:+ [translate_table: standard]
Sequence
MKNVEQLQEDLLSLAKKKKGKSQDDSQSNEDNGSIKKDVKHDSDISDSDDWNNKAGKTKK
KKSPSKRSKRKMTKSSSEDSASEKEPAKQLSEPEEGEVSDSDPSGSSSSQEEFNDGYDDK
LMGDAEDQARLAQMTEKEREQEIFKRIEQREIMKTRFEIEKKLRMAKKQELKKQKESKKK
EKGIEEKQKMDRAPDPKERSKDRKKTIEEKQDKKFHAMSLLKARREEKKEREEKEKQRIE
QQQQQSKDIEEEELEDDHKAAANKTKLKASDIYSDDSGSSDSGEEEEVTKPAPLRRSSSS
ESRDSDSDNDKKSITSNKARPKKPVYISTKEDLNKIRLSRHKMERFVHLPFFDRVVQGCF
VRIGIGNNNGKPVYRVAEISGVCETGKIYQLGGTRTNKGLKLRHGAQERVFRLEFVSNQE
FTDSEFFKWKETCALQGISTPTFDEVEQKLKDIKEALVYEFKEEDIEKIVREKERFKQTP
YNYAMKKAQLMRERDAANCRGDDETASRLNQELSELEERASELDKMRTATISSISYINDR
NRKKNVEEAEKAIMEELKANKGKKVDDPFTRRSTKPRMVYKPEDESEVVAVPVNDKSNPH
PTGDSVSAVDKENGQESKKKQSTEDLFDAHDFDITIDLEVPIPNNPVSVLPKPINNIKDT
GPRRSLNLEDYKKKRGLI
Download sequence
Identical sequences F4X8I8
Aech_01009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]