SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aech_03995 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_03995
Domain Number 1 Region: 1-236
Classification Level Classification E-value
Superfamily CutC-like 1.96e-66
Family CutC-like 0.00000564
Further Details:      
 
Domain Number 2 Region: 278-417
Classification Level Classification E-value
Superfamily Cytochrome P450 8.91e-41
Family Cytochrome P450 0.00025
Further Details:      
 
Weak hits

Sequence:  Aech_03995
Domain Number - Region: 241-277
Classification Level Classification E-value
Superfamily Cytochrome P450 0.0588
Family Cytochrome P450 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_03995
Sequence length 421
Comment [mRNA] locus=scaffold220:1835713:1849700:+ [translate_table: standard]
Sequence
MEICIDSLESARNAIEGGASRLEVCSALSEGGLTPSLGLVQQIKSFTMIPLYVMIRIRCG
DFIYSSEEIDAMLHDLKILKDHHVNGFVFGALTPDCEIDIVACEKIISAACPLPVTFNRA
FDLTNDPVKSMELLADLGFERILTSGQKNTALEGLELIKTLVQKTQKLVIMPGAGITKDN
IRKIMESGAKEFHASAKKRKMVVYGANRVRMGINNDDFVNVTDKELVKELVEIIKNENTL
QVLWKRLITLSNKYYPIYKNWIFFKPVISIHHPDDLKGHDTTASSLSFILALLAEHKDIQ
DRVRNEVDIVMQENENKLTMKFLHQLSYLERCIKEALRLHXTFFPHKSQNRHPYSYIPFS
AGPRNCIGQRYAMLQMKMITASLIHNFYLEPVDYIKDVRLQVDIVLHPHPLRVRFVPVLQ
N
Download sequence
Identical sequences F4WEA5
Aech_03995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]