SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aech_04263 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_04263
Domain Number 1 Region: 867-1040
Classification Level Classification E-value
Superfamily BRCA2 helical domain 5.62e-35
Family BRCA2 helical domain 0.0000481
Further Details:      
 
Domain Number 2 Region: 1041-1166
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.85e-32
Family Single strand DNA-binding domain, SSB 0.00013
Further Details:      
 
Domain Number 3 Region: 1381-1529
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.91e-30
Family Single strand DNA-binding domain, SSB 0.0042
Further Details:      
 
Domain Number 4 Region: 1171-1200,1306-1374
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.57e-20
Family Single strand DNA-binding domain, SSB 0.0095
Further Details:      
 
Weak hits

Sequence:  Aech_04263
Domain Number - Region: 1201-1294
Classification Level Classification E-value
Superfamily BRCA2 tower domain 0.0536
Family BRCA2 tower domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aech_04263
Sequence length 1647
Comment [mRNA] locus=scaffold482:1501310:1509372:+ [translate_table: standard]
Sequence
MDLPETDNAEDDSDELFSDDEQKKEIRHRSNVCQDTSVLSLSETPLSLLDYSPSTIMPTD
AVIPSTPLSLLPFLNKINEQWSSDLETPQAQPHMISTINTTEETPKGEQRTPDVSSVKSV
EKIISDSPVIASRASRRRSKRRIFKSSISIDPLAVTDNENITANVQVETPVISDDANSVA
QDDTTNAAISTSSLETTLKDDKPKVLDKSQDTCNDEELKNVTNDVPDSLNTSTQEFFNNV
SFSKIDELCLDTFNNQKTIETTVTQCNYEQNVDKERNIEENENIGFVTARGTSINVSKQA
LFKAKRLFADMDESTFDMDEMQTKNYESLVKRNKSNEEKDRYLPSSSFVSVNIAKEALPK
PKPFIEQLKNYDNVYTADCKKPLESKSSSEEVNKAPILLSTASGNPINISKKALLKAKAL
LADESHNINDDELIKYYERSTDKKSTTIKIKTLPSFSATSSKSISGESPIKARTLFAEHL
DDTVEVVVAEETNAHNKETKGLEIKMSNIKFKSPGSAVGISEQISKAKIFDKRLDDQVEP
VIANKVNKINEIENMQEVKIPSIGFQTAGGTYINISERALSKAKALFADELDCPLEMDIV
KNSDRDEEKIKKRDLAIPYGGLQTASDQEVPVSNNAALTARELFSNDCLDESNPDLGRAS
LQKRKLSETNVDGSTPQGRNYTSETKRARLSSEFQARKLFFDNTSTRTDNDENRDPDKKR
QTSSVVESTSGSPKTDSIESTESEVAGSPIIGRQSSLRKRKSLGYQRDESNTSRADNKML
DNENAALQENVVQGSATCGKIEDDKLNTEESTQATQEKAKGNSMGLSEYGDTQMMMDFID
QSTKVLQDRLAAALEQEAIITAKRRRAQSEGSKQSMGHLYRYKQINSNARLSMRQIGGGA
PPIPCSYQELIDRRISPRILEITAATAATYKFRCSDFYGDDVAHRNVRGIEMEDDVRLIL
DENGYAGIWEFLRAFLASSGVDPNLIPARWVENHYRWIVWKLASMDRMKFGSVKLPRALT
PSYVMAQLKYRYDREIDRSQRPAIRRILEKDDVPSKRMTLCVSSIIENNNVSMEIGKSPR
VGVPKWRIELTDGWYSTNACIDIGMVKNISTGKIREGTKLLLSGAELLNCDQGFYPLEAP
ADVCLKLHTNSTRRARWDTKLGYAPRSGPIPIKLRNVCPSGGLIGKMTIVVARVYPMLYY
EKTASGDSIVRNAKSEEKAQNKYEQQCWSKIESFYAQAEDFQGKELSGETDDMAIQLSED
YENLSTEESVSKKRHDELLQELRQKEERFKQRMQSKLRESLPGPRQVSQLLKVRVCDENA
NAILSVWSPSEEIVDALKEGACVSLCNIVASGKRGTELQLTARRSAIFKPGRMRDASYPA
RVCTSLDEIANSEFVPPYGEFDTVGLVCSVGPAPYGMRDFDAVHLAYCKTGSSESSYLSI
LFWQGIASYGYTEILTVGSIVACSNLEWRRATSWNVPAAYCTDRSTFTRNPRRNHLYESF
ENLRNLIMDPVKYAESCTFELNVELQKKSTPTRYSASKNTPIKMYSSTSNADKKLVDYMS
PLATPKLGVDNRSSVILSNPSIKKRLEKLQQYGEAPQLSPIILRNSKRICLDFRSPILPI
SDVNSTKETTNANQPEELKSSTSEKHS
Download sequence
Identical sequences F4WV33
Aech_04263 XP_011060427.1.86870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]