SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aech_11642 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_11642
Domain Number 1 Region: 316-373
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 9.68e-23
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00012
Further Details:      
 
Domain Number 2 Region: 5-49
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.0000000000000419
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00051
Further Details:      
 
Weak hits

Sequence:  Aech_11642
Domain Number - Region: 273-306
Classification Level Classification E-value
Superfamily ARM repeat 0.00432
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_11642
Sequence length 373
Comment [mRNA] locus=scaffold390:196661:199936:- [translate_table: standard]
Sequence
MALSQTSVLKLYNTVIEDVISGVRESFMDEGVDEQVLLELKQIWEGKLMASKAVELNPDP
PEPQVPQINTHKTVSVNKANVGNHFVQPSAGNTVSQTQPQQQSQQQQQQQVQAQPQQPSQ
PQQHTHPSTGTTLQQQQQHSTTPVQQVVTASAVLERQVPIQITLPPQAGVPDGPQRILSI
QVPASALQANQLHTILTGPVISAAMGLPANLASTLLQQHVNSTLQGQAALTPLQVNQPLQ
VVTQSTNSVVTQRPPQNQQQNNINQLDGGVGDSTDDDDEEEEEDNDDDDEDIDEKEEEEN
DEAAAREEEPLNSEDDVTDDDPADLFDTDNVVVCQYDKITRSRNKWKFYLKDGIMNLSGK
DYVFQKANGDAEW
Download sequence
Identical sequences F4WRE7
Aech_11642 XP_011058235.1.86870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]