SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aech_12571 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_12571
Domain Number 1 Region: 3-53
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 3.92e-18
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00016
Further Details:      
 
Domain Number 2 Region: 52-102
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 5.23e-18
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_12571
Sequence length 112
Comment [mRNA] locus=scaffold411:556633:557886:+ [translate_table: standard]
Sequence
MSYQLYRNTTLGNTLQESLDELIQYGQITPQLAIKVLLQFDKAINQALATRVKSRLTFKA
GKLNTYRFCDNVWTFMLNDVEFREVQEVAIVDKVKIVACDGKTLDADGAAKR
Download sequence
Identical sequences A0A151XDU4 A0A158NIM0 A0A195CRM4 F4WS91
XP_011058717.1.86870 XP_012057378.1.45171 XP_012542297.1.53737 XP_018048942.1.4000 XP_018317720.1.62676 XP_018338788.1.14990 XP_018394935.1.22276 Aech_12571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]