SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aech_08100 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_08100
Domain Number 1 Region: 28-163
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00000133
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aech_08100
Sequence length 294
Comment [mRNA] locus=scaffold274:198614:200344:- [translate_table: standard]
Sequence
MYASVIPYFLAAYVIINDTSEWTFGPEYSYDMNITYVIKPDPHDHVQKIQLISTVKCRPK
TSDTIFCHLYNITISEIFDNYNMTREAQTEQIFEIKFNEHGVEGLVIEPPSRMEVVNVLR
KIATQFNVIVDRRNIDTSQFMARENSTMGDCAAAYKIMREEAEIDTIEEINTNFRLRILP
LIDAKSGTTLSIEKSRMGCINPPRYVDFSRGILDMRRFISKIQINSNKFETFTEFDGIVR
FPTEESEMGTLSFKEIIQINLNSIEPAPNELPTLSYPELIDLNTNNDIPSNFIN
Download sequence
Identical sequences F4WHG1
Aech_08100 XP_011052963.1.86870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]