SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aech_08101 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_08101
Domain Number 1 Region: 6-121,153-239
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 0.000000000000165
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aech_08101
Sequence length 273
Comment [mRNA] locus=scaffold274:201336:202538:- [translate_table: standard]
Sequence
MIATELKCRPKGDDSLSCYFQNSLIKRPDPKDNRCSNAKDFVPTRYKFVGDEPFEIRFNS
KGIENLVVHRSIPRWRLDMIKSIVSQLNVGFEIQERRDRFTIMENSTVGHCEVDVKIVRN
PDFRENDDDSIEETEKFEIGFMPSNVELESPLVIERLQVEKIRQPKRCPRRIIYFFGNDE
DYSRGDKQLYMDMTTSTSHITISKDKFVSYTISEGVMKTANKSRIMRPYQKISLKLKRID
LIETLKISLPEIQNPASTSLFAFSNLQTIPEDE
Download sequence
Identical sequences F4WHG2
Aech_08101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]