SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aech_16743 from Acromyrmex echinatior v3.8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aech_16743
Domain Number 1 Region: 67-132
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0000798
Family Apolipoprotein 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aech_16743
Sequence length 423
Comment [mRNA] locus=scaffold409:10447:25051:+ [translate_table: standard]
Sequence
MENEIVLEKQLKPIIEPLKQIAGNTERGESQQQQQQVSPFDLRNEEVFKIGDDPSLETSV
RQVLNTPQGRQRLQNQLGPLGQDTQKDISNDVEKVQNNVEEVSRDVNALSTKVSNEIQRG
ITNLRQQMHNMVTKEVLKTNEIHRGVTDLRQRMNDMVTKETVRHQNPDKSNNSLSWQPQR
ASLMCTICIEGPPRQFDALLARLHQQSMLIFATIALGHPKSAFEPFQRLQGSSRCVLSSD
SSSLAYWNLRWTVLKPYILPQRHKQWISGIQRTELFPLLSARREELFYRLIEIADEVDDL
THVRINRIAFNRLIEIVDEAVKEEEVEEEEEEEEVEEESISTGVLKENVSAGIFKDPSPS
PPLEYPEDISELFNQIDELNLGIYLLSVLTIGQEEEKEGREERRRRDKNSAEDEEETEEE
EEE
Download sequence
Identical sequences F4WS71
Aech_16743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]