SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386717259|ref|YP_006183585.1| from Stenotrophomonas maltophilia D457

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386717259|ref|YP_006183585.1|
Domain Number 1 Region: 9-366
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 8.38e-105
Family FMN-linked oxidoreductases 0.00000000299
Further Details:      
 
Domain Number 2 Region: 339-525
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 9.06e-43
Family N-terminal domain of adrenodoxin reductase-like 0.0000101
Further Details:      
 
Domain Number 3 Region: 473-631
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.84e-20
Family C-terminal domain of adrenodoxin reductase-like 0.0000797
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386717259|ref|YP_006183585.1|
Sequence length 676
Comment 2,4-dienoyl-CoA reductase [Stenotrophomonas maltophilia D457]
Sequence
MSPANESAYPHLFAPLDLGFTQLRNRVLMGSMHTGLEDRARDFPRLAAYFAERAEGGVGL
IVTGGFAPNVVGWLKPFGGKLSWPWEVRPHRQLTAAAHQHGAKICLQLLHAGRYAYHPLS
VAPSKLKAPINPFTPRVLSASGVDRHIADYARSAKLAREAGYDGVEVMGSEGYLINEFIA
PRTNKRTDAWGGDARQRMRFAVEIVRRIREACGPDFIIIYRLSLVDLVDDGSSWEEIVQQ
AQAIEAAGATIINSGIGWHEARIPTIATSVPRAAFAGVTAKLKPHVKVPLVATNRINMPD
VAERILANGGADMVSLARPLLADPQWPNKARAGRAEAINTCIACNQACLDHVFENKLASC
LVNPRAAHETELVYHPTATPKKIAVVGAGPAGLACATVAAQRGHQVTLFDANDEIGGQFN
VAKRIPGKEEFHETLRYFRHKLAETGVQLRLGTRADAAQLTGFDEVVLATGITPRRVDFP
GADHARVVSYLDVLLGRVEVGASAAIIGAGGIGFDVGEFLSHAGESPSLDPQRWMAEWGV
DSTFEARGSLARPEVETSPRRLWLLQRSPGKPGARLGKTTGWIHRATLKAKGVRMLGGVE
YLGVDDAGLRIRVDGSEQLLPVDHVVICAGQEPNRALQAELQAAGINAQLIGGADVAAEL
DAKRAIDQGSRVAAGL
Download sequence
Identical sequences WP_014646069.1.58314 gi|386717259|ref|YP_006183585.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]