SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386717625|ref|YP_006183951.1| from Stenotrophomonas maltophilia D457

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386717625|ref|YP_006183951.1|
Domain Number 1 Region: 1518-1632
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000252
Family Fibronectin type III 0.01
Further Details:      
 
Domain Number 2 Region: 1342-1455
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000329
Family Fibronectin type III 0.0055
Further Details:      
 
Weak hits

Sequence:  gi|386717625|ref|YP_006183951.1|
Domain Number - Region: 1707-1794
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0231
Family Fibronectin type III 0.01
Further Details:      
 
Domain Number - Region: 1297-1361
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0629
Family Fibronectin type III 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386717625|ref|YP_006183951.1|
Sequence length 1795
Comment wall associated protein [Stenotrophomonas maltophilia D457]
Sequence
MRIWQWQALLGAALAMSSGWTWASSPVTPHTEYYKKIKNGEGLAPLTSSLFGDSISPSSG
STEFVVTDIDLPGNNALPVRLQRRLAVQSFKDRQPLGGFGSWDIEVAYMHATFDSIWKWN
ESGNGATQRCSQTFYPKTRTGVGTFEIWTGVQVRVPDQGEQEMLLIANASNPKPTNGETY
RWGTRGNMRLSCLGSTANGYPGEGFLGVDASGNRYFFNVGIERTAGFMELGQGMGSKLVR
VLLMASRVEDRHGNWVAYDYSGDKLVGIRGSDGRAISIAYAGDRIASAAANGRTWSYEYN
EGSGGMGFARWPALRAVQQPDGARLGYEYSWQDGGFGGLNPEYQSWDGEPKLCTKPTFEQ
SGFSLIATHPSGTRGQFEFKYLRRTRLGVKSTACADMGGGRYAQRASNAFDLFAITSKTL
TGPGLGNLTWTYESGGYDSGLPNSAVSTIVEPDGTRRHSVFGRKLDENEGQLLQEAVRAP
DGQIVQVTTNTYMSSDEVQAGPFPDSYGSMTAADDPFAVKIRPLKQSVLSQDGVNFVNTT
DQFDAHVRPVVQTESNSLGRSRTLRTTYFDDTGRWILGQVGRSTQSVGGVEIETERTEFD
SMARPQRTYAFGVLQQTLGYHADGTLASVADGKGNTIALGSWKRGLPQSVAYPDGSSASL
QVDDNGWVRAAVEPNGASRSFDYDGMGRIVLATQAANDSVAWNPSTTQFFQVPGAEIGLE
AGHWKRESSTGNARAVTYYDGLWRPVLEESFDAADRGGTLRQTVTRYDSNGRPVFTSYPT
RTASDFRSALPGTYTGYDALGRPNRSEQDSELGRLVTTTEQLGGGSVKVTNPRGIATTTD
YLMYGKPSQDTPIRILHAEGVVTEIQRDTLGKPLSILRRNYDGSVSVRRQYVYDGAQRLC
KSMEPETGATGMGYDAAGNLLWSASGLTLLGPQCESEAAYASPSRADRTYDSMNRLLTLR
FSDGQGDQDWNYWPGGKVKRVQTRNNGAITTNDYTYNLRGLPTSESVAYDGGEAWALGYG
YDANGALATHVQPSGLTIDYGPNALGQPTRAGAFAINVRYYANGGMSGFTYGNGVVHQMT
QNARGLPDRSTDSGAGGKVIDDGYDYDANGNVAAISDGLPAAPGNRDMRYDGLDRLTTVT
AASFGNASYAYNVLDNIVTANVGARRQSFEYDFNNRLTNVRDVGSGATVTGLGYDSQGNL
KIRNGVVFRFDYGNRLREVDGKEAYQYDAHGRRTLASATNGNIRSLYGQDGVLRYQHDQR
QAKGFDYIQLNGSLVAKRAVDIAPAALVVTVPGYSADGAFAVQWTAVAGAQRYEVQESSG
GDWQAVYQGPALNVSLAGRSSGVYRYRGRACNGTVCGAWGVEASIQVELAPTAAPVITAP
AQGINGTYSLSWSAVQGAARFVLEEAVGGGWNVAFDGSGRTYQVTSKPAGTYRYRVKACN
PQGCGAYSAEAAITALYAPSVPALSVPAASYNGSYAVSVSSVAQASSYRIEEQFNGGAWT
EINRISGNQLVISGRIAGSYAYRAFACNDAGCSASSAVGAIVVTLPPVQATGINLGGVSY
SSTVSMWWGAIPAATSYQLMEQLNGGGFGLAQEDGATAVARGGRWPGQWDYQVRGCNVAG
CGPWSAVAGVRVIGPPATPVLRVPDGVGIGAAYSISLLEVADATRYEIDESTDGANWSLI
AGDRTVSLNKGGGGNFYYRGRACNPAGCSPSSAAGLVAISSAPAVPTGVRIVKSGPNICS
VIWNASPGATYYNMRSSSGGATYRAEGIGYDLDTRCQGGYKVRACNAQACSAWSN
Download sequence
Identical sequences gi|386717625|ref|YP_006183951.1| WP_014646388.1.58314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]