SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os01g17250.1|PACid:21906943 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os01g17250.1|PACid:21906943
Domain Number 1 Region: 23-183
Classification Level Classification E-value
Superfamily L domain-like 7.23e-41
Family Polygalacturonase inhibiting protein PGIP 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os01g17250.1|PACid:21906943
Sequence length 214
Sequence
MAMAAAWSPALAAVLLAAAVASASNSEGDALYALRRALADPRGVLQSWDPTLVNPCTWFH
VTCDRAGRVTRLDLGNSNLSGHLAPELGHLEHLQYLELYKNNIQGTIPAELGSLKNLISL
DLYNNNITGTIPKELGKLSSLVFLRLNDNSLNGPIPRDLAKISSLKVIDVSNNDLCGTIP
TSGPFEHIPLNNFDKNPRLEGPELQGLATYDTNC
Download sequence
Identical sequences A0A0E0FK54 A0A0E0MUP5 A2WNH6 Q5NBR9
LOC_Os01g17250.1|PACid:21906943 XP_015621144.1.37577 39947.LOC_Os01g17250.1 LOC_Os01g17250.1|13101.m01932|protein ONIVA01G13800.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]