SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LOC_Os07g14680.1|PACid:21900931 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os07g14680.1|PACid:21900931
Domain Number 1 Region: 136-193
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000000754
Family Protein kinases, catalytic subunit 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LOC_Os07g14680.1|PACid:21900931
Sequence length 202
Sequence
MTKLAAAAAAVELPPIADVSAFSTTTSAARLALRDIAQTTVTMDTSSAATTESVTVSTSL
VLPELPSPVMVFELQEFSPAMSLPHRLGLPLRSSIVSDLILPSRGVTSPERLLLLRLSLE
ILVREFLGVTRLGSGQPPASIWSKDTTFSFGDILAATKHFNDAYCIGKGSFGTVYRANLG
GGRAVAVKQLDASETGDACCGS
Download sequence
Identical sequences Q8GSL1
39947.LOC_Os07g14680.1 LOC_Os07g14680.1|PACid:21900931 LOC_Os07g14680.1|13107.m01541|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]