SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for LOC_Os08g10310.1|PACid:21891276 from Oryza sativa v193

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LOC_Os08g10310.1|PACid:21891276
Domain Number 1 Region: 671-959
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.19e-80
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 79-398
Classification Level Classification E-value
Superfamily L domain-like 1.87e-52
Family Polygalacturonase inhibiting protein PGIP 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LOC_Os08g10310.1|PACid:21891276
Sequence length 1024
Sequence
MGGVSGKLVWVLLVMCSSWLIAAVHAQQAATTDPIEVAALEAILGRWGKTTSPLWRMSGE
PCRGVPVDGSTDLDGNPKNNPGIKCDCSYNSGTVCHITQLRVYALNVVGQIPAELQNLTY
LTYLNLDQNYLSGPIPSFIGQLTALTELHVGFNPLSGSLPKELGNLTNLNLLGISLTNFS
GQLPEELGNLTKLRQLYTDSAGLSGPFPSTLSRLKNLKLLRASDNNFTGTIPDFIGSLSN
LEDLAFQGNSFEGPIPASLSNLTKLTTLRIGDIVNGSSSLAFISSLTSLDTLVLRNCKIS
GDLGAVDFSKFANLTFLDLSFNNISGNVPKSILNLQKLIFLFLGNNSLTGELPDGISPSL
TNLDFSYNQLTGSFPSWVTQNNLQLNLVANNFILGSTNIGMLPPGLNCLQEDTPCFRGSP
KYYSFAVDCGSNRSIRVSDNTMYELDSTNLGDSSYYVTSQTRWGVSNVGKLFQAPNDSKI
IHSGEKIQNAVDSELFQTARMSPSSLRYYGLGLENGNYTVLLKFAELGFPDTPTWQSLGR
RFFDIYIQGELKEKDFNIRKMAGGKSFTAVYKSYTTTVSKNFLEIHLFWAGKGTCCIPIQ
GYYGPLISALSITPNFSPTVRNGVPKKKSKAGAIVGIVIAASVLGSAILFGIFMVIKKRR
RMAKQQEELYNLVGQPDVFSNAELKLATDNFSSQNILGEGGYGPVYKGVLPDGRVIAVKQ
LSQSSHQGKSQFVTEVATISAVQHRNLVKLHGCCIDSNTPLLVYEYLKNGSLDKALFGNG
SIKLDWATRFEIILGIARGLTYLHEESSVRIVHRDIKASNVLLDTDLTPKISDFGLAKLY
DEKKTHVSTGIAGTFGYLAPEYAMRRHLTEKVDVFAFGVVALEIVAGRSNTDNSLEESKI
YLFEWAWSLYEKEQALGIVDPRLEEFSRDEVYRVIHVALICTQGSPYQRPPMSKVVAMLT
GDVEVAEVVTKPNYITEWQFRGGNTSYVTSHSGSTTPKLSRQKEIDPLTQSPTITGVSHE
HEGR
Download sequence
Identical sequences Q6ZKW7
XP_015649961.1.37577 39947.LOC_Os08g10310.1 LOC_Os08g10310.1|PACid:21891276 LOC_Os08g10310.1|13108.m01094|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]